PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36571
Common NameKK1_036014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 230aa    MW: 25814.1 Da    PI: 8.3793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36571genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++lvd+++++G  +W+t ++  g+ R++k+c++rw +yl
    C.cajan_36571 13 KGAWSKQEDQKLVDYINKHGEVCWRTLPQAAGLLRCGKSCRLRWINYL 60
                     79******************99**********99************97 PP

2Myb_DNA-binding56.18.7e-1866110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++
    C.cajan_36571  66 RGNFSEDEEDLIVKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      89********************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.948860IPR017930Myb domain
SuperFamilySSF466891.8E-2711107IPR009057Homeodomain-like
SMARTSM007171.4E-121262IPR001005SANT/Myb domain
PfamPF002494.5E-141360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-211467IPR009057Homeodomain-like
CDDcd001673.99E-101560No hitNo description
PROSITE profilePS5129427.15761115IPR017930Myb domain
SMARTSM007171.6E-1665113IPR001005SANT/Myb domain
PfamPF002494.6E-1666110IPR001005SANT/Myb domain
CDDcd001673.73E-1268111No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2668116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MRKPSCDIKD LNKGAWSKQE DQKLVDYINK HGEVCWRTLP QAAGLLRCGK SCRLRWINYL  60
RPDLKRGNFS EDEEDLIVKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRRKLISKGI  120
DPNNHRLKHS IPNLENPPMS DDSSKPCGTK DISKNETSKS PHVYNSGEVS DAASGEAESS  180
CALPDLNLDL SIAIPSASPT VSENNIAPFH ESNSSRKMHF ESPSTLLLFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3081152108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1356031e-116BT135603.1 Lotus japonicus clone JCVI-FLLj-12J12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528525.11e-143PREDICTED: myb-related protein 308-like
SwissprotQ9SZP11e-74MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A151RJ801e-170A0A151RJ80_CAJCA; Transcription repressor MYB4
STRINGGLYMA07G33960.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.18e-76myb domain protein 4